mass spectrometry is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-02-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
Reconstitution introduces additional variables: solvent choice, pH, ionic strength, and filtration. Many sequences dissolve readily in water, while hydrophobic ones may need acetonitrile, dimethyl sulfoxide, or a small amount of base. Adding solvent slowly and avoiding vigorous vortexing can reduce foaming and shear-induced aggregation. If the solution appears cloudy, filtration may remove particulates but can also remove aggregated peptide and alter concentration. A clear solution does not by itself confirm correct sequence or purity, so analytical checks remain necessary.
Temperature logs and cold-chain documentation help identify excursions that may compromise a batch. Automated freezers, desiccant packs, and sealed containers limit moisture and frost accumulation. Aliquoting small portions before freezing reduces the number of times the main stock changes temperature. Labels should include peptide name, lot, concentration if known, solvent, and date prepared. Periodic analytical verification by high-performance liquid chromatography or mass spectrometry can detect degradation, truncation, or sequence errors that visual inspection cannot reveal.
After reconstitution, solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. Aliquots should be labeled with peptide identity, concentration, solvent, and date, then stored at the temperature specified by the supplier or protocol. Many peptides tolerate -20 °C for short periods, while -80 °C is preferred for longer storage. Frost-free freezers are generally avoided because temperature fluctuations can stress samples. Aseptic technique and sterile filters reduce microbial contamination, though filtration can also remove aggregated material or bind some peptides.
Peptide handling begins with careful receipt and inventory. Containers should be inspected for damage, label information should match the certificate of analysis, and storage location should be recorded. Many lyophilized peptides are electrostatic and may cling to vial walls or weighing paper, which can complicate transfer. Allowing a cold vial to equilibrate to room temperature before opening reduces condensation on the contents. Clean tools, gloves, and a low-humidity workspace limit contamination and moisture exposure during manipulation.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or polypropylene | Glass is relatively inert but can adsorb; polypropylene may leach. |
| Headspace gas | Argon or nitrogen | Inert gas displaces oxygen for oxidation-prone sequences. |
| Equilibration before opening | 20–30 minutes at room temperature | Sealed vial warms gradually to reduce condensation. |
| Typical aliquot size | Small working portions | Limits repeated temperature cycling of the main stock. |
| Documentation fields | Lot, date, solvent, concentration | Supports traceability and degradation monitoring. |
Cold-chain shipping uses insulated containers, phase-change packs, and temperature indicators. Dry ice maintains -70 °C or lower but requires venting to avoid pressure buildup. Gel packs provide 2-8 °C for shorter transit. Upon arrival, recipients should record temperature indicators and transfer vials promptly to storage. Deviations from specified conditions should be documented and may require analytical re-check. The effect of a brief temperature excursion is peptide-specific and not always predictable from general rules.
Handling begins with receipt and inspection. Vials should be checked for damage, label integrity, and temperature history. Lyophilized peptides should be allowed to equilibrate to room temperature before opening to prevent condensation. Solutions should be prepared in a clean, calibrated environment using appropriate solvents. Personal protective equipment and containment reduce exposure and contamination. Documentation of lot number, date, and storage location supports traceability. The goal is to limit repeated temperature changes, moisture exposure, and microbial contamination.
After reconstitution, solutions are divided into single-use aliquots and stored at -80°C. Labels include peptide name, concentration, buffer composition, date, and lot number. Freeze-thaw cycles are minimized by thawing only the needed aliquot on ice or at room temperature. Some peptides benefit from the addition of a carrier protein, such as bovine serum albumin, or a cryoprotectant like glycerol to reduce adsorption to plastic. Glass vials with low-binding surfaces are preferred for dilute solutions. Shipping of frozen aliquots uses dry ice and insulated containers to maintain the cold chain.
Receiving a peptide shipment requires immediate inspection of the packaging and temperature indicators. Any deviation from the specified cold chain should be documented and investigated. Upon arrival, solid peptides are generally kept at -20°C, whereas liquid formulations are stored at -80°C. Vials should be kept upright and protected from light. Repeated warming and cooling of the entire container is avoided by preparing smaller working aliquots. A log of lot numbers, receipt dates, and storage locations supports traceability and quality control.
Reconstitution is a critical handling step. The appropriate solvent—often sterile water, phosphate-buffered saline, or a water-acetonitrile mixture—is chosen based on peptide solubility. Adding solvent gently down the vial wall and swirling, rather than vortexing, reduces foaming and shear stress. The resulting solution should be clear; visible particles indicate incomplete dissolution or contamination. Concentration is recorded accurately because it affects subsequent use. If the peptide is not fully soluble, a small amount of organic solvent or a different buffer may be required, but this changes the final composition.
Reconstitution introduces new risks because the peptide contacts solvent, air, and container surfaces. The chosen solvent should match the peptide's solubility profile, and buffer salts, pH, and ionic strength can affect dissolution and subsequent stability. Gentle mixing is preferred over vigorous vortexing, which can create interfaces and shear. If the solution is not clear, the cause may be incomplete dissolution, aggregation, or insoluble counter-ions rather than a simple concentration problem. Filtration is sometimes used, but filters can adsorb peptides and alter measured concentration.
Cold-chain practice relies on documented temperature ranges, calibrated monitoring, and minimized excursions. Shipments may use insulated boxes, phase-change materials, or dry ice, with data loggers to record conditions. Upon receipt, the recipient should verify the logger trace and place items into long-term storage promptly. Repeated warming and cooling during transfers can be more harmful than a single controlled excursion. For solutions, dividing material into single-use aliquots reduces the number of thawing and refreezing events and limits repeated opening of the same container.
Handling begins before a peptide arrives at the bench. Containers should be inspected for cracks, loose caps, or visible moisture, and labels should record identity, lot, and receipt date. Lyophilized material is often allowed to equilibrate to room temperature before opening to prevent condensation on the powder. Gloves and a clean workspace reduce contamination and static-related loss. Once opened, the vial may be purged with inert gas and resealed if the peptide is sensitive to oxygen or humidity. These steps are procedural safeguards rather than guarantees of stability.
This system was firstly described in 1989 by Fields and Song using Saccharomyces cerevisiae as biological model. Yeast two hybrid allows the identification of pairwise PPIs (binary method) in vivo, in which the two proteins are tested for biophysically direct interaction. The Y2H is based on the functional reconstitution of the yeast transcription factor Gal4 and subsequent activation of a selective reporter such as His3. To test two proteins for interaction, two protein expression constructs are made: one protein (X) is fused to the Gal4 DNA-binding domain (DB) and a second protein (Y) is fused to the Gal4 activation domain (AD). In the assay, yeast cells are transformed with these constructs. Transcription of reporter genes does not occur unless bait (DB-X) and prey (AD-Y) interact with each other and form a functional Gal4 transcription factor. Thus, the interaction between proteins can be inferred by the presence of the products resultant of the reporter gene expression. In cases in which the reporter gene expresses enzymes that allow the yeast to synthesize essential amino acids or nucleotides, yeast growth under selective media conditions indicates that the two proteins tested are interacting. Recently, software to detect and prioritize protein interactions was published. Despite its usefulness, the yeast two-hybrid system has limitations. It uses yeast as main host system, which can be a problem when studying proteins that contain mammalian-specific post-translational modifications.
== Works == Valko has authored various books throughout her career. In 1994, she co-authored a book titled Chromatographic Determination of Molecular Interactions with Tibor Cserháti. The book focused on the theory and practical application of measuring molecular interactions using various chromatographic techniques, compiling methods for calculating stability constants and presenting new results for a broad range of interactions. Her 2014 book titled Physicochemical and Biomimetic Properties in Drug Discovery: Chromatographic Techniques for Lead Optimization emphasized the importance of measuring physicochemical and biomimetic properties in early drug discovery. Moreover, in her multi-volume book series Separation Methods in Drug Synthesis and Purification, she provided an overview of analytical techniques in drug synthesis and purification, covering topics such as enantiomer separation, computer simulation for method development, and advancements in chromatography and preparative methods.
More sanctions were eased on 13 February, with the issue of two licenses allowing international companies to operate oil and gas projects in Venezuela and to negotiate contracts. Payments go to a US-controlled foreign government deposit fund. US energy secretary that visited the Venezuela in February, said that oil sales have hit $1 billion since January and would hit another $5 billion in months. The US Treasury Department indicated that companies working of Venezuelan oil trade have to pay local taxes, permits and fees to the government of Venezuela, while royalties and federal taxes must be paid into a fund managed by the United States. During the 2026 State of the Union Address, Trump announced that the US "just received from our new friend and partner, Venezuela, more than 80 million barrels of oil." According to the Reuters in February, the Venezuelan oil ministry cancelled 19 contracts with private companies on oil and gas in Venezuela signed under the government of Nicolás Maduro. Venezuelan and US administrations are reviewing the credentials of the companies that signed them. In March, the United States issued a license to authorize the trade of Venezuelan gold and allow deals with Minarven, Venezuela's state-owned gold mining company. On 28 August 2026, President Donald Trump announced that the United States had reached an oil agreement with Venezuela's interim government, led by Delcy Rodríguez. Trump stated on his social media platform that the agreement would give the United States majority control over 65 billion barrels of proven oil reserves in Venezuela.
=== Stepwise Assembly === More complex cage architectures often require stepwise assembly strategies. This approach involves the systematic construction of cage fragments followed by their controlled combination into the final structure. While more time-consuming, stepwise assembly offers greater control over the final product and is particularly useful for asymmetric cage structures. The key advantage of this method lies in its ability to isolate and characterize intermediate products, ensuring the quality of each synthetic step. For instance, in the synthesis of large cages, building blocks can be first combined into smaller sub-cages or fragments, which are then purified before final assembly. This strategy is particularly valuable when working with expensive or sophisticated building blocks, as it minimizes material waste and allows for optimization of each step.
== Trends in outbreaks of produce-related illness == An analysis of 3,500 food-poisoning outbreaks between 1990 and 2003 found that contaminated produce was responsible for the greatest number of individual foodborne illnesses. The study, by the Center for Science in the Public Interest, found that produce caused 428 outbreaks and 23,857 cases of illness. Authorities note that several factors have contributed to the rise in outbreaks:
Sources: en.wikipedia.org
Nussio, Enzo; Ugarriza, Juan E. (2021). "Why Rebels Stop Fighting: Organizational Decline and Desertion in Colombia's Insurgency". International Security. 45 (4): 167–203. doi:10.1162/isec_a_00406. hdl:20.500.11850/480000. ISSN 0162-2889. Sherman, John W. "Political Violence in Colombia: Dirty Wars Since 1977." History Compass (Sep 2015) 13#9 pp 454–465. Cirlig, Carmen-Cristina. "Colombia: new momentum for peace?" (PDF). Library Briefing. Library of the European Parliament. Retrieved July 15, 2013. Azcarate, Camilo A. (March 1999). "Psychosocial Dynamics of the Armed Conflict in Colombia". Online Journal of Peace and Conflict Resolution. Archived from the original on January 6, 2003. James Petras (July 2, 1988). "Neglected Dimensions of Violence". Economic and Political Weekly. 23 (27): 1367. JSTOR 4378701. Elizabeth F. Schwartz (Winter 1995–1996). "Getting Away with Murder: Social Cleansing in Colombia and the Role of the United States". The University of Miami Inter-American Law Review. 27 (2): 381–420. John Lindsay-Poland (January–February 2010). "Retreat to Colombia: The Pentagon Adapts Its Latin America Strategy". NACLA Report on the Americas. Government/NGO reports
=== Other === To prevent the accumulation of fluid under the graft which can prevent its attachment and revascularization, the graft is frequently meshed by making lengthwise rows of short, interrupted cuts, each a few millimeters long, with each row offset by half a cut length like bricks in a wall. In addition to allowing for drainage, this allows the graft to both stretch and cover a larger area as well as to more closely approximate the contours of the recipient area. However, it results in a rather pebbled appearance upon healing that may ultimately look less aesthetically pleasing. An increasingly common aid to both pre-operative wound maintenance and post-operative graft healing is the use of negative pressure wound therapy (NPWT). This system works by placing a section of foam cut to size over the wound, then laying a perforated tube onto the foam. The arrangement is then secured with bandages. A vacuum unit then creates negative pressure, sealing the edges of the wound to the foam, and drawing out excess blood and fluids. This process typically helps to maintain cleanliness in the graft site, promotes the development of new blood vessels, and increases the chances of the graft successfully taking. NPWT can also be used between debridement and graft operations to assist an infected wound in remaining clean for a period of time before new skin is applied. Skin grafting can also be seen as a skin transplant.
== Transport == The two paralogous enzymes- transmembrane CD38 and GPI anchored CD157, that produce NAADP (and cADPR) in humans both have their active synthesis site in the ectodomain. Though this may involve vesicular synthesis but it has been shown that it is produced at the extracellular sites, and also can act when produced by a different cell or added artificially from outside. So the NAADP has to enter the cell either by diffusion or by transport. Considering the fact that the substrate of NAADP synthesis (NADP) itself is very sparse in the extracellular medium, a purse diffusion based mechanism has been suspected to be less likely than a transporter mediated path. This is compatible with recent data which indicate a carrier mediated transport partially blockable by dipyridamole and cold temperature.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
A non-Newtonian liquid is one where the viscosity is not independent of these factors and either thickens (increases in viscosity) or thins (decreases in viscosity) under shear. Examples of non-Newtonian liquids include ketchup, custard, or starch solutions.
Sources: en.wikipedia.org
Work quickly in a dry environment and keep the container closed when not in use. Equilibrate sealed vials to room temperature before opening to reduce condensation. Record mass changes, as absorbed water can affect concentration calculations.
Liquid storage is generally shorter than dry storage because water enables hydrolysis, oxidation, and microbial growth. If solution storage is necessary, use sterile technique, appropriate pH, and cold temperatures. Aliquot to avoid repeated temperature changes.
Reversed-phase high-performance liquid chromatography is common for purity assessment, while mass spectrometry confirms molecular mass and can reveal modifications. Amino acid analysis or sequencing may be used when sequence information is critical. These methods complement visual inspection and storage records.
It should first equilibrate to room temperature in a sealed container to prevent condensation on the cold contents. Opening too soon can introduce moisture and reduce stability, and the waiting period depends on vial size and packaging.