compound-index.peptides6155.com › Guide › Stability, Storage, And Testing — 2026 Update

Stability, Storage, And Testing — 2026 Update

By Editorial Desk · published 2025-05-05 · last reviewed 2025-06-21 · Guide

Karl Fischer titration comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.

Updated 2025-06-21. Numbers and descriptions here follow the published literature rather than marketing material.

Stability, Storage, and Testing

Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.

Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.

Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.

Chemical Identity And Natural Role

Several creatine forms are sold, including monohydrate, anhydrous, hydrochloride, nitrate, citrate, and blends. Once dissolved, these forms deliver creatine, but they differ in molar mass, solubility, counterions, and water content. Creatine monohydrate has the largest body of published human data among these forms. Questions remain about whether any alternative form offers meaningful advantages in absorption, tolerability, or tissue uptake under practical conditions. The hydrate form's lower creatine content by mass is a compositional fact, not a statement about effectiveness.

Creatine monohydrate is a crystalline compound formed when one molecule of creatine associates with one molecule of water in the solid lattice. Its molecular formula is C4H11N3O3, and its molar mass is about 149.15 grams per mole. The material appears as a white, odorless powder that dissolves sparingly in water at room temperature. The monohydrate designation distinguishes it from anhydrous creatine, which lacks the bound water and has a lower molar mass. This hydrate is the most common commercial form of creatine used in nutritional and research settings.

Creatine-monohydrate at a glance

PropertyValueNotes
Typical storage temperature15-25 °CSealed container; protect from moisture and direct heat.
Theoretical water contentAbout 12.1%One water molecule per creatine molecule.
Primary degradation productCreatinineFormed by cyclization, especially in aqueous solution.
Common analytical methodHPLC-UVUsed to separate creatine from creatinine and related impurities.
Regulatory classification (U.S.)Dietary supplement ingredientOther jurisdictions may classify it as a food supplement or novel food depending on rules.

Identity, Natural Role, and Forms

In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.

Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.

Related pages on this site

Notes from published material

An anticancer drug is coupled to an antibody that targets a specific tumor antigen (or protein) that, ideally, is only found in or on tumor cells. The biochemical reaction that occurs upon attaching triggers a signal in the tumor cell, which then absorbs, or internalizes, the antibody together with the linked cytotoxin. After the ADC is internalized, the cytotoxin kills the cancer. Their targeting ability was believed to limit side effects for cancer patients and to give a wider therapeutic window than other chemotherapeutic agents, although this promise hasn't yet been realized in the clinic. ADC technologies have been featured in many publications, including scientific journals.

The Department works at the intersection of organic chemistry (chemistry of natural products, chemistry of macrocyclic compounds, chemistry of elementorganic compounds), supramolecular chemistry (solution and self-process chemistry) and molecular biology. The head of the Department is Professor Igor S. Antipin, a corresponding member of the Russian Academy of Science, Doctor of Chemistry. The Department conducts research in the following fields:

Lewis acids have been classified in the ECW model and it has been shown that there is no one order of acid strengths. The relative acceptor strength of Lewis acids toward a series of bases, versus other Lewis acids, can be illustrated by C-B plots. It has been shown that to define the order of Lewis acid strength at least two properties must be considered. For Pearson's qualitative HSAB theory the two properties are hardness and strength while for Drago's quantitative ECW model the two properties are electrostatic and covalent. Monoprotic acids, also known as monobasic acids, are those acids that are able to donate one proton per molecule during the process of dissociation (sometimes called ionization) as shown below (symbolized by HA):

The iron-containing co-factor is found tightly associated with the protein. It can be released upon denaturation with 2-mercaptoethanol or guanidine hydrochloride. Expression of the Hmd gene in E. coli without the co-factor results in an inactive holoenzyme. However, hydrogenase activity can be rescued by the addition of the iron-containing cofactor taken from denatured active enzyme. As mentioned, irradiation of the cofactor with UV light results in the loss of CO and Fe. In addition the 542 Da compound can be further degraded by a phosphodiesterase (which specifically cleaves phosphate bonds). Hydrolysis of the phosphate bonds generates the ribonucleotide guanosine monophosphate and a modified 2-pyridone. On the basis of spectroscopic characterization, Shima et al. have proposed a structure for this organic cofactor (minus the iron atom and CO molecules) as shown:

A 2004 essay on the relation between car colour and safety stated that no previous studies had been scientifically conclusive. Since then, a Swedish study found that pink cars are involved in the fewest and black cars are involved in the most crashes (Land transport NZ 2005). In Auckland New Zealand, a study found that there was a significantly lower rate of serious injury in silver cars, with higher rates in brown, black, and green cars. The Vehicle Colour Study, conducted by Monash University Accident Research Centre (MUARC) and published in 2007, analysed 855,258 crashes that occurring between 1987 and 2004 in the Australian states of Victoria and Western Australia that resulted in injury or in a vehicle being towed away. The study analysed risk by light condition. It found that in daylight, black cars were 12% more likely than white to be involved in a collision, followed by grey cars at 11%, silver cars at 10%, and red and blue cars at 7%, with no other colours found to be significantly more or less risky than white. At dawn or dusk, the risk ratio for black cars jumped to 47% more likely than white, and that for silver cars to 15%. In the hours of darkness, only red and silver cars were found to be significantly more risky than white, by 10% and 8% respectively.

Sources: en.wikipedia.org

Further detail

The amino acids in an α-helix are arranged in a right-handed helical structure where each amino acid residue corresponds to a 100° turn in the helix (i.e., the helix has 3.6 residues per turn), and a translation of 1.5 Å (0.15 nm) along the helical axis. Dunitz describes how Pauling's first article on the theme in fact shows a left-handed helix, the enantiomer of the true structure. Short pieces of left-handed helix sometimes occur with a large content of achiral glycine amino acids, but are unfavorable for the other normal, biological L-amino acids. The pitch of the alpha-helix (the vertical distance between consecutive turns of the helix) is 5.4 Å (0.54 nm), which is the product of 1.5 and 3.6. The most important thing is that the N-H group of one amino acid forms a hydrogen bond with the C=O group of the amino acid four residues earlier; this repeated i + 4 → i hydrogen bonding is the most prominent characteristic of an α-helix. Official international nomenclature specifies two ways of defining α-helices, rule 6.2 in terms of repeating φ, ψ torsion angles (see below) and rule 6.3 in terms of the combined pattern of pitch and hydrogen bonding. The α-helices can be identified in protein structure using several computational methods, such as DSSP (Define Secondary Structure of Protein).

The removal of dead cells by neighboring phagocytic cells has been termed efferocytosis. Dying cells that undergo the final stages of apoptosis display apoptotic-cell associated molecular patterns (ACAMPs), such as phosphatidylserine on the outer leaflet of the cell membrane. Phosphatidylserine is normally found on the inner leaflet surface of the plasma membrane, but is redistributed during apoptosis to the extracellular surface by a protein known as scramblase. These molecules mark the cell for phagocytosis by cells possessing the appropriate receptors, such as macrophages. The removal of dying cells by phagocytes occurs in an orderly manner without eliciting an inflammatory response. During apoptosis cellular RNA and DNA are separated from each other and sorted to different apoptotic bodies; separation of RNA is initiated as nucleolar segregation.

P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Sources: en.wikipedia.org

Supporting material

The first definition of the term bioinformatics was coined by Paulien Hogeweg and Ben Hesper in 1970, to refer to the study of information processes in biotic systems. This definition placed bioinformatics as a field parallel to biochemistry (the study of chemical processes in biological systems). Bioinformatics and computational biology involved the analysis of biological data, particularly DNA, RNA, and protein sequences. The field of bioinformatics experienced explosive growth starting in the mid-1990s, driven largely by the Human Genome Project and by rapid advances in DNA sequencing technology. Analyzing biological data to produce meaningful information involves writing and running software programs that use algorithms from graph theory, artificial intelligence, soft computing, data mining, image processing, and computer simulation. The algorithms in turn depend on theoretical foundations such as discrete mathematics, control theory, system theory, information theory, and statistics.

2A peptides are a class of 18–22 aa-long peptides, which can induce ribosomal skipping during translation of a protein in a biological cell. These peptides share a core sequence motif of DxExNPGP, and are found in a wide range of viral families. 2A peptides can be introduced artificially to help generate polyproteins from a single ORF, by causing the ribosome to fail at making a peptide bond, and then resume translation. The members of 2A peptides are named after the virus in which they have been first described. For example, F2A, the first described 2A peptide, is derived from foot-and-mouth disease virus. The name "2A" itself comes from the gene numbering scheme of this virus. These peptides are also known as "self-cleaving" peptides, which is a known misnomer, because the missing peptide bond is never synthesized by the ribosome, and is thus not cleaved.

Genetically modified organism History of biotechnology An Asilomar Moment Archived 10 July 2013 at the Wayback Machine Original Asilomar Genetics Guidelines “Asilomar Conference.” Provides another summary of the Asilomar Conference. The Basics of Recombinant DNA provides an introduction to the science behind recombinant DNA. The Recombinant DNA Debate Archived 31 March 2007 at the Wayback Machine provides more details about the history of the debate surrounding the use of recombinant DNA technology. “Paul Berg: The 1980 Nobel Prize in Chemistry – Autobiography.” Provides an autobiography about Paul Berg. Science History Institute: The story of the 1975 Asilomar Conference on Recombinant DNA

The Shrake–Rupley algorithm is a numerical method that draws a mesh of points equidistant from each atom of the molecule and uses the number of these points that are solvent accessible to determine the surface area. The points are drawn at a water molecule's estimated radius beyond the van der Waals radius, which is effectively similar to 'rolling a ball' along the surface. All points are checked against the surface of neighboring atoms to determine whether they are buried or accessible. The number of points accessible is multiplied by the portion of surface area each point represents to calculate the ASA. The choice of the 'probe radius' does have an effect on the observed surface area, as using a smaller probe radius detects more surface details and therefore reports a larger surface. A typical value is 1.4Å, which approximates the radius of a water molecule. Another factor that affects the results is the definition of the VDW radii of the atoms in the molecule under study. For example, the molecule may often lack hydrogen atoms, which are implicit in the structure. The hydrogen atoms may be implicitly included in the atomic radii of the 'heavy' atoms, with a measure called the 'group radii'. In addition, the number of points created on the van der Waals surface of each atom determines another aspect of discretization, where more points provide an increased level of detail.

APEKTx1 is a highly selective blocker of the voltage-gated potassium channel Kv1.1 with no effect on other tested potassium channels (Kv1.2, Kv1.3, Kv1.4, Kv1.5, Kv1.6, Shaker IR, Kv2.1, Kv3.1, Kv4.2 and Kv4.3). APEKTx1 selectively blocks Kv1.1 channels with an IC50 value of 0.9 nM, which makes it between a 700 to 3000 times more potent inhibitor than the two known sea anemone peptides targeted against Kv channels (kalicludines and SHTX II). APEKTx1 is thought to interact with Kv1.1 through the aliphatic residue alanine (A352), an acidic residue glutamate (E353), and an aromatic residue tyrosine (Y379), as a mutation in these sites causes a loss in affinity of the toxin for Kv1.1. These residues are located in the H5-loop between the S5 and S6 domains and are part of the channel’s pore. In addition, APEKTx1 acts as a potent trypsin inhibitor (Kd= 124 nM), probably a competitive one. However, trypsin inhibition is more potent (as it has a higher affinity) in BPTI, which can be explained by the presence of Phe13 and Pro19 in APEKTx1, causing an unfavorable interaction.

Sources: en.wikipedia.org

Frequently asked questions

How should creatine monohydrate be stored?

A sealed container at room temperature, away from moisture and direct heat, is suitable for most solid material. Keeping the lid closed limits water uptake and caking. Long-term storage in a refrigerator is not necessary if the powder remains dry.

What causes creatine to break down?

Heat, moisture, and prolonged time in solution promote conversion to creatinine. The reaction is faster at higher temperatures and at pH values far from neutral. Dry powder is much more stable than dissolved material.

How is purity checked?

Common methods include high-performance liquid chromatography for creatine and creatinine, plus water-content analysis by Karl Fischer titration. Heavy metals, residual solvents, and microbial limits may also be tested. A specification may list total creatine content and impurity limits.

What is creatine monohydrate?

It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.

Network