HPLC raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-07-06. Anything still debated is marked as such rather than presented as settled.
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
Creatine is synthesized endogenously in humans, mainly in the liver, kidney, and pancreas, from the amino acids arginine, glycine, and methionine. Skeletal muscle stores much of the body's creatine, where it participates in the phosphocreatine system that buffers adenosine triphosphate during short, intense contractions. Dietary sources include meat and fish, so omnivorous diets provide additional creatine beyond endogenous production. Supplemental creatine monohydrate supplies the same molecule found in food and tissues, not a distinct drug or hormone. Research interest centers on its role in cellular energy transfer and its effects on muscle and other tissues.
Several creatine forms are sold, including monohydrate, anhydrous, hydrochloride, nitrate, citrate, and blends. Once dissolved, these forms deliver creatine, but they differ in molar mass, solubility, counterions, and water content. Creatine monohydrate has the largest body of published human data among these forms. Questions remain about whether any alternative form offers meaningful advantages in absorption, tolerability, or tissue uptake under practical conditions. The hydrate form's lower creatine content by mass is a compositional fact, not a statement about effectiveness.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 15–25 °C | Cool, dry, away from moisture |
| Relative humidity | < 50% | High humidity promotes degradation |
| Primary degradation product | Creatinine | Formed via cyclization, especially in solution |
| Common analytical method | HPLC-UV | Often at 210 nm; also titration or NMR |
| Shelf life (solid) | 2–3 years | When kept sealed and dry; varies by manufacturer |
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
In the body, creatine is synthesized from arginine, glycine, and methionine, mainly in the liver and kidneys, and is also obtained from foods such as meat and fish. About 95% of body creatine is stored in skeletal muscle, where a fraction is phosphorylated to phosphocreatine. Phosphocreatine serves as a rapid reserve of high-energy phosphate for short bursts of ATP regeneration. The monohydrate form supplies creatine after dissolution and absorption, but it is not itself the active phosphorylated species.
Creatine was first identified in skeletal muscle extracts in the nineteenth century, and its role in phosphagen energy buffering was clarified in the twentieth century. The monohydrate salt became widely studied after methods for inexpensive synthesis and crystallization were developed. Modern research examines its effects on muscle energetics, recovery, and cognitive performance under specific conditions. Findings vary with population, exercise protocol, baseline creatine status, and measurement method. Studies often compare supplementation with placebo during controlled training or testing schedules.
Creatine monohydrate is a hydrated form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. Its molecular formula is C4H9N3O2·H2O, with a molar mass around 149.15 g/mol. The monohydrate is the most common solid form used in research and commercial settings because it crystallizes readily and remains stable under ordinary conditions. The term monohydrate indicates one water molecule per creatine molecule in the crystal lattice. It appears as a white crystalline powder with low odor.
Cannabis Analytical Science Program (CASP) is a forum where the science of hemp and cannabis analysis can be discussed and cannabis standards and methods developed. Analytical Solutions Forum (ASF) brings global stakeholders together to identify emerging needs and technologies in scientific analysis of food and related products. === Botanical Ingredients and Dietary Supplement Integrity Program === AOAC’s Botanical Ingredient and Dietary Supplement Integrity (BIDSI) Program focuses on coordinating all future consensus-driven need for development, validation, and implementation of methods for the analysis of a wide range of botanical ingredients and dietary supplements. === Stakeholder Program on Infant Formula and Adult Nutritionals === Stakeholder Program on Infant Formula and Adult Nutritionals program (SPIFAN) develops consensus-based standards and methods to make infant formula and adult nutritionals safer for babies and adults to consume.
K a = [ H + ] [ A − ] [ HA ] {\displaystyle K_{a}={\frac {{\ce {[H+] [A^{-}]}}}{{\ce {[HA]}}}}} The stronger of two acids will have a higher Ka than the weaker acid; the ratio of hydrogen cations to acid will be higher for the stronger acid as the stronger acid has a greater tendency to lose its proton. Because the range of possible values for Ka spans many orders of magnitude, a more manageable constant, pKa is more frequently used, where pKa = −log10 Ka. Stronger acids have a smaller pKa than weaker acids. Experimentally determined pKa at 25 °C in aqueous solution are often quoted in textbooks and reference material. Arrhenius acids are named according to their anions. In the classical naming system, the ionic suffix is dropped and replaced with a new suffix, according to the table following. The prefix "hydro-" is used when the acid is made up of just hydrogen and one other element. For example, HCl has chloride as its anion, so the hydro- prefix is used, and the -ide suffix makes the name take the form hydrochloric acid. Classical naming system:
The reaction catalyzed by 1-aminocyclopropane-1-carboxylic acid synthase (ACS) is the committed and rate-limiting step in the biosynthesis of ethylene [20], a gaseous plant hormone that is responsible for the initiation of fruit ripening, shoot and root growth and differentiation, leaf and fruit abscission, flower opening, and flower and leaf senescence. (source) It is a pyridoxal phosphate (PLP) dependent gamma-elimination (?). In the gamma elimination, PLP acts as a sink twice (absorbing electrons from two deprotonations). Proposed steps of the reaction mechanism: Formation of the ACS-PLP Schiff Base Imine Exchange Formation of the Quinonoid Intermediate Tyrosine and PLP stabilized 3C-Ring formation Formation of the ACS-PLP Schiff Base The aldehyde of coenzyme PLP reacts to form an imine (Schiff base) linkage with the catalytic domain lysine (278) residue of ACS. Imine exchange An imine exchange occurs, and the amine nitrogen of the substrate, S-Adenosyl methionine, replaces Lys (278) in the imine linkage. (Stabilized by H bonding).
3-phosphoglycerate can be separated and measured using paper chromatography as well as with column chromatography and other chromatographic separation methods. It can be identified using both gas-chromatography and liquid-chromatography mass spectrometry and has been optimized for evaluation using tandem MS techniques. 2-Phosphoglyceric acid Calvin-Benson cycle Photosynthesis Ribulose 1,5-bisphosphate
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Microscale manipulation and patterning of biological materials such as proteins, cells and tissues have been used in the development of cell-based arrays, microarrays, microfabrication based tissue engineering, and artificial organs. Biological micropatterning can be used for high-throughput single cell analysis, precise control of cellular microenvironment, as well as controlled integration of cells into appropriate multi-cellular architectures to recapitulate in vivo conditions. Photolithography, microcontact printing, selective microfluidic delivery, and self-assembled monolayers are some methods used to pattern biological molecules onto surfaces. Cell micropatterning can be done using microcontact patterning of extracellular matrix proteins, cellular electrophoresis, optical tweezer arrays, dielectrophoresis, and electrochemically active surfaces.
Sources: en.wikipedia.org
Agonists PACAP-38 (endogenous peptide agonist, full length version) - also activates other receptors VIP, GPR55 and MRGPRX2 and the Secretin receptor. PACAP-27 (endogenous peptide agonist, shorter fragment which retains activity) Antagonists PACAP(6-38) - N-terminal truncated version of the endogenous peptide agonist which acts as a potent PAC1 antagonist BAY 2686013 PA-915 "VIP and PACAP Receptors: PAC1". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. Human ADCYAP1R1 genome location and ADCYAP1R1 gene details page in the UCSC Genome Browser. This article incorporates text from the United States National Library of Medicine, which is in the public domain.
The inverted terminal repeat (ITR) sequences comprise 145 bases each. They were named so because of their symmetry, which was shown to be required for efficient multiplication of the AAV genome. The feature of these sequences that gives them this property is their ability to form a hairpin, which contributes to so-called self-priming that allows primase-independent synthesis of the second DNA strand. The ITRs were also shown to be required for both integration of the AAV DNA into the host cell genome (19th chromosome in humans) and rescue from it, as well as for efficient encapsidation of the AAV DNA combined with generation of a fully assembled, deoxyribonuclease-resistant AAV particles. With regard to gene therapy, ITRs seem to be the only sequences required in cis next to the therapeutic gene: structural (cap) and packaging (rep) proteins can be delivered in trans. With this assumption many methods were established for efficient production of recombinant AAV (rAAV) vectors containing a reporter or therapeutic gene. However, it was also published that the ITRs are not the only elements required in cis for the effective replication and encapsidation. A few research groups have identified a sequence designated cis-acting Rep-dependent element (CARE) inside the coding sequence of the rep gene. CARE was shown to augment the replication and encapsidation when present in cis.
The Shrake–Rupley algorithm is a numerical method that draws a mesh of points equidistant from each atom of the molecule and uses the number of these points that are solvent accessible to determine the surface area. The points are drawn at a water molecule's estimated radius beyond the van der Waals radius, which is effectively similar to 'rolling a ball' along the surface. All points are checked against the surface of neighboring atoms to determine whether they are buried or accessible. The number of points accessible is multiplied by the portion of surface area each point represents to calculate the ASA. The choice of the 'probe radius' does have an effect on the observed surface area, as using a smaller probe radius detects more surface details and therefore reports a larger surface. A typical value is 1.4Å, which approximates the radius of a water molecule. Another factor that affects the results is the definition of the VDW radii of the atoms in the molecule under study. For example, the molecule may often lack hydrogen atoms, which are implicit in the structure. The hydrogen atoms may be implicitly included in the atomic radii of the 'heavy' atoms, with a measure called the 'group radii'. In addition, the number of points created on the van der Waals surface of each atom determines another aspect of discretization, where more points provide an increased level of detail.
TNF is a cytokine produced mainly by activated macrophages, and is the major extrinsic mediator of apoptosis. Most cells in the human body have two receptors for TNF: TNFR1 and TNFR2. The binding of TNF to TNFR1 has been shown to initiate the pathway that leads to caspase activation via the intermediate membrane proteins TNF receptor-associated death domain (TRADD) and Fas-associated death domain protein (FADD). cIAP1/2 can inhibit TNF signaling by binding to TRAF2. FLIP inhibits the activation of caspase-8. Binding of this receptor can also indirectly lead to the activation of transcription factors involved in cell survival and inflammatory responses. However, signalling through TNFR1 might also induce apoptosis in a caspase-independent manner. The link between TNF and apoptosis shows why an abnormal production of TNF plays a fundamental role in several human diseases, especially in autoimmune diseases. The TNF receptor superfamily also includes death receptors (DRs), such as DR4 and DR5. These receptors bind to the protein TRAIL and mediate apoptosis. Apoptosis is known to be one of the primary mechanisms of targeted cancer therapy. Luminescent iridium complex-peptide hybrids (IPHs) have recently been designed, which mimic TRAIL and bind to death receptors on cancer cells, thereby inducing their apoptosis.
Sources: en.wikipedia.org
Yes, especially when exposed to moisture or heat, where it converts to creatinine. In dry, sealed containers at room temperature, degradation is slow and the product may remain within specification for two to three years.
Common methods include high-performance liquid chromatography, titration, and nuclear magnetic resonance spectroscopy. These techniques quantify the parent compound and detect related substances such as creatinine.
Keep the powder in a tightly sealed container in a cool, dry place, ideally between 15 and 25 degrees Celsius with low humidity. Avoid storing aqueous solutions for extended periods because degradation occurs faster in solution.
It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.