A practical reference on lyophilization: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-10-11. Anything still debated is marked as such rather than presented as settled.
Peptides are short amino acid polymers whose stability depends on sequence, length, and chemical modifications. In dry form, most peptides are relatively stable because low water activity slows hydrolysis and other degradation. Residual moisture, oxygen, and light can still promote oxidation, deamidation, or aggregation over time. Storage recommendations therefore usually combine low temperature, desiccation, and protection from light. Because each peptide has distinct properties, no single condition fits every sequence.
Temperature selection balances degradation rate against physical changes. Many lyophilized peptides are stored at -20 °C, while some modified or longer sequences require -80 °C for extended periods. Aqueous stock solutions are less stable and are often kept at -20 °C or below in single-use aliquots. Repeated freeze-thaw cycles can cause aggregation, precipitation, or loss of activity, so aliquoting before freezing reduces that risk. Frost-free freezers cycle above freezing and may be unsuitable for long-term peptide storage.
Peptides are short chains of amino acids linked by amide bonds, and their storage stability depends on sequence, length, and three-dimensional structure. Chemical degradation can occur through hydrolysis, oxidation, deamidation, and aggregation, while physical changes such as precipitation or surface adsorption reduce recovery. Storage conditions are chosen to slow these processes without altering the peptide itself. Because peptides vary widely, no single condition suits every sequence, so laboratories often establish stability empirically for each batch.
Temperature is a primary factor because most degradation reactions proceed more slowly at lower temperatures. Lyophilized peptides are commonly held at -20 °C or below, although some sequences remain stable at 2–8 °C for limited periods. Moisture uptake during handling can accelerate hydrolysis, so sealed containers and desiccants are used. Solutions are generally less stable than powders and may require freezing at -80 °C or refrigeration, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation even when the storage temperature is otherwise suitable.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized powder | Common shipping and storage form; hygroscopic after opening. |
| Typical storage temperature | -20 °C | Desiccated and protected from light; some sequences require -80 °C. |
| Solubility class | Sequence-dependent | Often soluble in water or dilute buffer; some require an organic modifier. |
| Moisture sensitivity | Moderate to high | Sealed containers with desiccant reduce hydrolysis and aggregation. |
| Light sensitivity | Variable | Amber vials or opaque wrapping limit photodegradation. |
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, conformation, and the surrounding matrix. In the solid state, lyophilized powders are generally more stable than solutions because low water activity slows hydrolysis and oxidation. Residual moisture, oxygen, trace metals, and light can still promote degradation over time. Storage recommendations therefore balance temperature, humidity, and container integrity rather than relying on a single condition. The optimal condition for a given peptide is often determined empirically because no universal rule covers every sequence.
In aqueous solution, peptides are vulnerable to hydrolysis, oxidation, deamidation, and aggregation, with rates influenced by pH, temperature, buffer composition, and ionic strength. Acidic or neutral pH ranges often slow deamidation, while extreme pH can accelerate peptide bond cleavage. Dissolved oxygen and redox-active metal ions contribute to oxidation of methionine, cysteine, and tryptophan residues. Aggregation may be driven by hydrophobic interactions or by interfaces such as air-liquid and container surfaces. Because these pathways interact, solution storage usually requires tighter control than storage of dried material.
Temperature is a primary factor in peptide storage. Lower temperatures reduce molecular motion and slow degradation reactions, but freezing can concentrate solutes and promote aggregation. Lyophilized powders are commonly held at -20°C, whereas solutions are often kept at -80°C. Repeated freeze-thaw cycles are harmful because ice crystal formation and pH shifts can damage the peptide. The glass transition temperature of a lyophilized cake influences its stability; below this temperature, molecular mobility is restricted. For solutions, the choice between -20°C and -80°C depends on the peptide's sensitivity and the intended storage duration.
Moisture, oxygen, and light also affect peptide integrity. Lyophilized powders absorb water from the air, which can enable hydrolysis and conformational changes. Oxygen promotes oxidation of sensitive residues, so storage under inert gas or in sealed vials is common. Light exposure can cause photodegradation, particularly for peptides containing aromatic amino acids. Buffer choice and pH influence charge state and solubility; extremes of pH accelerate deamidation and hydrolysis. Adding stabilizers such as sugars or polyols can protect the peptide during freezing and drying. Optimal conditions are determined empirically for each peptide.
Weight regain is common upon discontinuation of weight loss medications, and long-term therapy may sometimes be required for sustained weight loss. After stopping treatment with GLP-1 agonists such as semaglutide, liraglutide and tirzepatide, people regain on average more than half (50–70%) of the lost weight within 1 year. People return to their previous weight within a year and a half after stopping anti-obesity medications. Media related to Anti-obesity drugs at Wikimedia Commons Prescription Medications to Treat Overweight & Obesity US National Institute of Diabetes and Digestive and Kidney Diseases
Aviation Safety Network Established in 1996. The ASN Safety Database contains descriptions of over 15800 airliner, military and corporate jet aircraft accidents/incidents since 1921. Bureau of Aircraft Accidents Archives Established in 2000. The B3A contains descriptions of over 22,000 airliner, military and corporate jet aircraft accidents since 1918. National Transportation Safety Board Aviation Accident Synopses – by month Aviation Statistics Statistical and geospatial analysis of general aviation accidents. Aviation Accidents App Access the NTSB Aviation Accidents Database and Final Reports from all over the world on your mobile device Aviation Accidents Map Explore an interactive map showcasing airplane crash sites Air Crash Map | Interactive Aviation Accident Database
Moving forward, though, the potential for real biological computers is immense. We are essentially talking about fully-functional computers that can sense their surroundings, and then manipulate their host cells into doing just about anything. Biological computers might be used as an early-warning system for disease, or simply as a diagnostic tool ... Biological computers could tell their host cells to stop producing insulin, to pump out more adrenaline, to reproduce some healthy cells to combat disease, or to stop reproducing if cancer is detected. Biological computers will probably obviate the use of many pharmaceutical drugs. UC Berkeley biochemical engineer Jay Keasling said the transcriptor "clearly demonstrates the power of synthetic biology and could revolutionize how we compute in the future".
Sources: en.wikipedia.org
In intrinsic termination, self-complementary sequences within the RNA transcript cause it to double back and form base pairs with itself, creating an RNA stem-loop or hairpin structure. This structure is critical for the release of both the transcript and polymerase at the end of transcription. In living cells, the key components are the stable stem-loop itself, as well as the sequence of 6–8 uracil residues that follow it. The stem usually consists of 8–9 mostly guanine and cytosine (G–C) base pairs, and the loop consists of 4–8 residues. It is thought that the stem portion of the structure is essential for transcription termination, while the loop is not. This is suggested by the fact that termination can be achieved in non-native structures that do not include the loop. The stem portion of the hairpin is usually rich in G–C base pairs. G–C base pairs have significant base-stacking interactions, and can form three hydrogen bonds with each other, which makes them very thermodynamically favorable. Conversely, while the uracil-rich sequence that follows the hairpin is not always necessary for termination, it is hypothesized that the uracil-rich sequence aids in intrinsic termination because the U–A bond is not as strong as G–C bonds. This inherent instability acts to kinetically favor the dissociation of the RNA transcript.
Blood compatibility testing is routinely performed before a blood transfusion. The full compatibility testing process involves ABO and RhD (Rh factor) typing; screening for antibodies against other blood group systems; and crossmatching, which involves testing the recipient's blood plasma against the donor's red blood cells as a final check for incompatibility. If an unexpected blood group antibody is detected, further testing is warranted to identify the antibody and ensure that the donor blood is negative for the relevant antigen. Serologic crossmatching may be omitted if the recipient's antibody screen is negative, there is no history of clinically significant antibodies, and their ABO/Rh type has been confirmed against historical records or against a second blood sample; and in emergencies, blood may be transfused before any compatibility testing results are available. Blood compatibility testing is often performed on pregnant women and on the cord blood from newborn babies, because incompatibility puts the baby at risk for developing hemolytic disease of the newborn. It is also used before hematopoietic stem cell transplantation, because blood group incompatibility can be responsible for some cases of acute graft-versus-host disease.
Alexander Butlerov Institute of Chemistry trains students for school chemical Olympiads of the Republic of Tatarstan and the Russian Federation. At various times, professors of the Institute of Chemistry headed Russian teams at International School Chemistry Olympiad among them were Andrey N. Vedernikov, Arkady I. Kuramshin and Igor A. Sedov; The old building of the Alexander Butlerov Institute of Chemistry since it was built in 1953, was not only a laboratory building of chemical faculty of Kazan University, at different times, it also placed historical-philological faculty of Kazan University, military department, some rooms were used as a hostel for young teachers and graduate students of the University.
Sources: en.wikipedia.org
Arrestins block GPCR coupling to G proteins in two ways. First, arrestin binding to the cytoplasmic face of the receptor occludes the binding site for heterotrimeric G-protein, preventing its activation (desensitization). Second, arrestin links the receptor to elements of the internalization machinery, clathrin and clathrin adaptor AP2, which promotes receptor internalization via coated pits and subsequent transport to internal compartments, called endosomes. Subsequently, the receptor could be either directed to degradation compartments (lysosomes) or recycled back to the plasma membrane where it can again signal. The strength of arrestin-receptor interaction plays a role in this choice: tighter complexes tend to increase the probability of receptor degradation (Class B), whereas more transient complexes favor recycling (Class A), although this rule is far from absolute. More recently direct interactions between Gi/o family G proteins and Arrestin were discovered downstream of multiple receptors, regardless of canonical G protein coupling. These recent findings introduce a GPCR signaling mechanism distinct from canonical G protein activation and β-arrestin desensitization in which GPCRs cause the formation of Gαi:β-arrestin signaling complexes.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Water chemistry analyses are carried out to identify and quantify the chemical components and properties of water samples. The type and sensitivity of the analysis depends on the purpose of the analysis and the anticipated use of the water. Chemical water analysis is carried out on water used in industrial processes, on waste-water stream, on rivers and stream, on rainfall and on the sea. In all cases the results of the analysis provides information that can be used to make decisions or to provide re-assurance that conditions are as expected. The analytical parameters selected are chosen to be appropriate for the decision-making process or to establish acceptable normality. Water chemistry analysis is often the groundwork of studies of water quality, pollution, hydrology and geothermal waters. Analytical methods routinely used can detect and measure all the natural elements and their inorganic compounds and a very wide range of organic chemical species using methods such as gas chromatography and mass spectrometry. In water treatment plants producing drinking water and in some industrial processes using products with distinctive taste and odors, specialized organoleptic methods may be used to detect smells at very low concentrations.
The MT-ND6 gene is located in human mitochondrial DNA from base pair 14,149 to 14,673. MT-ND6 is the only protein-coding gene located on the L-strand of the human mitogenome. The encoded protein is 18 kDa and composed of 172 amino acids. MT-ND6 is one of seven mitochondrial genes encoding subunits of the enzyme NADH dehydrogenase (ubiquinone), together with MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND4L, and MT-ND5. Also known as Complex I, this enzyme is the largest of the respiratory complexes. The structure is L-shaped with a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm that includes all the known redox centres and the NADH binding site. MT-ND6 and the rest of the mitochondrially encoded subunits are the most hydrophobic of the subunits of Complex I and form the core of the transmembrane region.
Sources: en.wikipedia.org
Dry powders have low water activity, which slows hydrolysis and many chemical degradation routes. Solutions provide mobility and water for reactions, so they typically degrade faster even when refrigerated. Lyophilization itself does not make a peptide immune to oxidation or moisture uptake.
No. Many lyophilized peptides remain suitable at -20 °C for routine periods, while some sequences or modified products may need colder storage. The optimal condition depends on sequence, formulation, expected duration, and supplier data. Stability testing, not assumption, establishes the appropriate condition.
Repeated freezing and thawing can concentrate solutes, promote aggregation, and cause precipitation or adsorption losses. Preparing single-use aliquots limits the number of cycles a given portion experiences. Some peptides tolerate cycling better than others, so empirical stability data are useful.
Removing water reduces hydrolytic and some oxidative degradation. Powder forms are generally more stable for long-term storage than solutions. Stability still depends on peptide sequence, residual moisture, and container conditions.